Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT5M Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310056100UL
Description
NT5M Polyclonal specifically detects NT5M in Human samples. It is validated for Western Blot.Specifications
NT5M | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
3'-nucleotidase, mitochondrialDNT2, 5', 5' nucleotidase, mitochondrial, 5(3)-deoxyribonucleotidase, Deoxy-5'-nucleotidase 2, dNT2, dNT-25'(3')-deoxyribonucleotidase, mitochondrial, EC 3.1.3, EC 3.1.3.-, mdN, mitochondrial 5' nucleotidase | |
The immunogen is a synthetic peptide directed towards the C terminal region of human NT5M (NP_064586.1). Peptide sequence LLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAI | |
100 μg | |
Lipid and Metabolism | |
56953 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction