Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT5M Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | NT5M |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NT5M Polyclonal specifically detects NT5M in Human samples. It is validated for Western Blot.Specifications
| NT5M | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS buffer, 2% sucrose | |
| 56953 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 3'-nucleotidase, mitochondrialDNT2, 5', 5' nucleotidase, mitochondrial, 5(3)-deoxyribonucleotidase, Deoxy-5'-nucleotidase 2, dNT2, dNT-25'(3')-deoxyribonucleotidase, mitochondrial, EC 3.1.3, EC 3.1.3.-, mdN, mitochondrial 5' nucleotidase | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human NT5M (NP_064586.1). Peptide sequence LLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAI | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title