Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NTPCR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	NTPCR
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP238724 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP238724	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB436117 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23872425UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NTPCR Polyclonal specifically detects NTPCR in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	NTPCR
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Kinase
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	C1orf57, chromosome 1 open reading frame 57, EC 3.6.1.15, FLJ11383, HCR-NTPase, human cancer-related NTPase, MGC13186, NTPase, Nucleoside triphosphate phosphohydrolase, nucleoside-triphosphatase C1orf57, nucleoside-triphosphatase, cancer-related, RP4-678E16.2
Gene Symbols	NTPCR
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q9BSD7
Gene ID (Entrez)	84284
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPV
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NTPCR Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents