NUBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157039

Catalog No. NBP157039

Description

NUBP1 Polyclonal specifically detects NUBP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NUBP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P53384
• Gene Symbols: NUBP1
• Immunogen: Synthetic peptides corresponding to NUBP1 (nucleotide binding protein 1 (MinD homolog, E. coli)) The peptide sequence was selected from the N terminal of NUBP1. Peptide sequence MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 4682
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.