Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NUBP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NUBP1 Polyclonal specifically detects NUBP1 in Human samples. It is validated for Western Blot.Specifications
NUBP1 | |
Polyclonal | |
Rabbit | |
P53384 | |
4682 | |
Synthetic peptides corresponding to NUBP1 (nucleotide binding protein 1 (MinD homolog, E. coli)) The peptide sequence was selected from the N terminal of NUBP1. Peptide sequence MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
cytosolic Fe-S cluster assembly factor NUBP1, MGC117406, MGC130053, NBP 1, NBP1, NBPMGC130052, nucleotide binding protein (e.coli MinD like), nucleotide binding protein 1 (E.coli MinD like), nucleotide binding protein 1 (MinD homolog, E. coli), Nucleotide-binding protein 1 | |
NUBP1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title