Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nuclear Factor Erythroid Derived 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Nuclear Factor Erythroid Derived 2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Nuclear Factor Erythroid Derived 2 Polyclonal specifically detects Nuclear Factor Erythroid Derived 2 in Mouse samples. It is validated for Western Blot.Specifications
| Nuclear Factor Erythroid Derived 2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| Leucine zipper protein NF-E2, NF-E2, nuclear factor (erythroid-derived 2), 45kD, nuclear factor (erythroid-derived 2), 45kDa, Nuclear factor, erythroid-derived 2 45 kDa subunit, p45, p45 NF-E2, transcription factor NF-E2 45 kDa subunit | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Nuclear Factor Erythroid Derived 2 (NP_032711). Peptide sequence ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 4778 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title