NUDCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155000

Catalog No. NBP155000

Description

NUDCD1 Polyclonal specifically detects NUDCD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NUDCD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Chronic myelogenous leukemia tumor antigen 66, CML66OVA66, FLJ14991, NudC domain containing 1, nudC domain-containing protein 1, Tumor antigen CML66
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96RS6
• Gene Symbols: NUDCD1
• Immunogen: Synthetic peptides corresponding to NUDCD1(NudC domain containing 1) The peptide sequence was selected from the N terminal of NUDCD1. Peptide sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84955
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG