Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDCD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NUDCD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NUDCD1 Polyclonal specifically detects NUDCD1 in Human samples. It is validated for Western Blot.Specifications
NUDCD1 | |
Polyclonal | |
Rabbit | |
Q96RS6 | |
84955 | |
Synthetic peptides corresponding to NUDCD1(NudC domain containing 1) The peptide sequence was selected from the N terminal of NUDCD1. Peptide sequence EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Chronic myelogenous leukemia tumor antigen 66, CML66OVA66, FLJ14991, NudC domain containing 1, nudC domain-containing protein 1, Tumor antigen CML66 | |
NUDCD1 | |
IgG | |
67 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title