Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUDT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	NUDT12
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP152974 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP152974	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NUDT12 Polyclonal specifically detects NUDT12 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NUDT12
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q9BQG2
Gene ID (Entrez)	83594
Immunogen	Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Lipid and Metabolism
Gene Alias	DKFZp761I172, EC 3.6.1.22, nucleoside diphosphate linked moiety X-type motif 12, Nucleoside diphosphate-linked moiety X motif 12, nudix (nucleoside diphosphate linked moiety X)-type motif 12, Nudix motif 12, peroxisomal NADH pyrophosphatase NUDT12
Gene Symbols	NUDT12
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NUDT12 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents