Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDT12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NUDT12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
NUDT12 Polyclonal specifically detects NUDT12 in Human samples. It is validated for Western Blot.Specifications
NUDT12 | |
Polyclonal | |
Purified | |
RUO | |
Q9BQG2 | |
83594 | |
Synthetic peptides corresponding to NUDT12(nudix (nucleoside diphosphate linked moiety X)-type motif 12) The peptide sequence was selected from the C terminal of NUDT12. Peptide sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
Lipid and Metabolism | |
DKFZp761I172, EC 3.6.1.22, nucleoside diphosphate linked moiety X-type motif 12, Nucleoside diphosphate-linked moiety X motif 12, nudix (nucleoside diphosphate linked moiety X)-type motif 12, Nudix motif 12, peroxisomal NADH pyrophosphatase NUDT12 | |
NUDT12 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title