NUDT15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238436

Catalog No. NBP238436

Description

NUDT15 Polyclonal specifically detects NUDT15 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NUDT15
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9NV35
• Gene Symbols: NUDT15
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 8-oxo-dGTPase NUDT15, A730068G11Rik, EC 3.1.6.-, FLJ10956, MTH2MGC104352, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15, nudix (nucleoside diphosphate linked moiety X)-type motif 15, Nudix motif 15, nudix-type motif 15, probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15, RP11-90M2.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55270
• Target Species: Human
• Isotype: IgG