NUDT16L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15543220UL

Catalog No. NBP15543220

Description

NUDT16L1 Polyclonal specifically detects NUDT16L1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NUDT16L1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9BRJ7
• Gene Symbols: NUDT16L1
• Immunogen: Synthetic peptides corresponding to NUDT16L1(nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1) The peptide sequence was selected from the C terminal of NUDT16L1. Peptide sequence GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLN
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84309
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC11275, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1, protein syndesmos, SDOSNUDT16-like protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified