Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUDT16L1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15543220UL
Description
NUDT16L1 Polyclonal specifically detects NUDT16L1 in Human samples. It is validated for Western Blot.Specifications
NUDT16L1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9BRJ7 | |
NUDT16L1 | |
Synthetic peptides corresponding to NUDT16L1(nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1) The peptide sequence was selected from the C terminal of NUDT16L1. Peptide sequence GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLN | |
Protein A purified | |
RUO | |
84309 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC11275, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1, protein syndesmos, SDOSNUDT16-like protein 1 | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction