Nuf2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255985

Catalog No. NBP255985

Description

Nuf2 Polyclonal specifically detects Nuf2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Nuf2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: cancer/testis antigen 106, CDCA1hsNuf2, cell division cycle associated 1, Cell division cycle-associated protein 1, CT106, hNuf2, kinetochore protein Nuf2, NUF2, NDC80 kinetochore complex component, homolog (S. cerevisiae), NUF2RhNuf2R
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NUF2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILTGADGKNLTKNDLYPNPKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPHLMEGFLPFSNLVTHLDSF
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 83540
• Target Species: Human
• Isotype: IgG

For Research Use Only