NUFIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255795

Catalog No. NBP255795

Description

NUFIP2 Polyclonal specifically detects NUFIP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NUFIP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 182-FIP, Cell proliferation-inducing gene 1 protein, FIP-82, FLJ10976, FMRP-interacting protein 2, Fragile X Mental Retardation Protein, KIAA1321PIG1,82-FIP82-kD FMRP Interacting Protein, MGC117262, nuclear fragile X mental retardation protein interacting protein 2, nuclear fragile X mental retardation-interacting protein 2, proliferation-inducing gene 1,82 kDa FMRP-interacting protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NUFIP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NSGYITNGYMGKGADNDGSGSESGYTTPKKRKARRNSAKGCENLNIVQDKIMQQETSVPTLKQGLETFKPDYSEQKGNRVDGSKPIWKYETG
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 57532
• Target Species: Human
• Isotype: IgG

For Research Use Only