Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NUP133 Rabbit anti-Human, Polyclonal, Novus Biologicals™

NUP133 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB120143 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB120143 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB120143 Supplier Novus Biologicals Supplier No. NBP310998100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

NUP133 Polyclonal specifically detects NUP133 in Human samples. It is validated for Western Blot.

Specifications

Antigen NUP133
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ10814, hNUP133,133 kDa nucleoporin, MGC21133, nuclear pore complex protein Nup133, nucleoporin 133kD, nucleoporin 133kDa, Nucleoporin Nup133
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NUP133 (NP_060700.2). Peptide sequence QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55746
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.