NUP98 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158188

Catalog No. NBP158188

Description

NUP98 Polyclonal specifically detects NUP98 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NUP98
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADAR2, ADIR2, GLFG-repeat containing nucleoporin, nuclear pore complex protein Nup98-Nup96, nucleoporin 98kD, nucleoporin 98kDa, NUP196, NUP96, Nup98-Nup96
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%; Mouse: 92%; Pig: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A8KA17
• Gene Symbols: NUP98
• Immunogen: Synthetic peptides corresponding to NUP98(nucleoporin 98kDa) The peptide sequence was selected from the N terminal of NUP98. Peptide sequence EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF.
• Quantity: 100 μL
• Research Discipline: Cancer, Mitotic Regulators
• Gene ID (Entrez): 4928
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.