Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NUP98 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NUP98 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NUP98 Polyclonal specifically detects NUP98 in Human samples. It is validated for Western Blot.Specifications
NUP98 | |
Polyclonal | |
Rabbit | |
Cancer, Mitotic Regulators | |
ADAR2, ADIR2, GLFG-repeat containing nucleoporin, nuclear pore complex protein Nup98-Nup96, nucleoporin 98kD, nucleoporin 98kDa, NUP196, NUP96, Nup98-Nup96 | |
NUP98 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
A8KA17 | |
4928 | |
Synthetic peptides corresponding to NUP98(nucleoporin 98kDa) The peptide sequence was selected from the N terminal of NUP98. Peptide sequence EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title