Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NUPL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	NUPL1
Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB438355 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP21368425UL	25ul	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP213684 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP213684	0.1 mL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NUPL1 Polyclonal specifically detects NUPL1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	NUPL1
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human, Mouse, Rat
Gene Alias	KIAA0410PRO2463, nucleoporin like 1, nucleoporin p58/p45, Nucleoporin-like protein 1
Gene Symbols	NUP58
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human NUPL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	9818
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: RNTLNIDKLKIETALELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKI
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NUPL1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents