Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™

O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™
SDP

Catalog No. NB396087 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396087 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396087 Supplier Novus Biologicals Supplier No. NBP24859825UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

O-GlcNAc Transferase p110 subunit Polyclonal antibody specifically detects O-GlcNAc Transferase p110 subunit in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen O-GlcNAc Transferase p110 subunit
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias EC 2.4.1, EC 2.4.1.255, FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCY
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other smAll species molecules, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8473
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.