Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™

O-GlcNAc Transferase p110 subunit Antibody, Novus Biologicals™
SDP

Catalog No. NB395098 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395098 25 μL
NBP255252 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB395098 Supplier Novus Biologicals Supplier No. NBP25525225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

O-GlcNAc Transferase p110 subunit Polyclonal specifically detects O-GlcNAc Transferase p110 subunit in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen O-GlcNAc Transferase p110 subunit
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 2.4.1, EC 2.4.1.255 FLJ23071, HRNT1, MGC22921, O-GLCNAC, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase), O-linked N-acetylglucosamine transferase 110 kDa subunit, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit, uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase
Gene Symbols OGT
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cellular Markers, Golgi Apparatus Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8473
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.