OA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21406625UL

Catalog No. NB438108

Description

OA1 Polyclonal specifically detects OA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OA1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: G protein-coupled receptor 143, G-protein coupled receptor 143, NYS6, OA1Ocular albinism type 1 protein, ocular albinism 1 (Nettleship-Falls)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GPR143
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPT
• Quantity: 25ul
• Research Discipline: GPCR
• Gene ID (Entrez): 4935
• Target Species: Human
• Isotype: IgG

For Research Use Only