OAS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15895220UL

Catalog No. NBP15895220

Description

OAS2 Polyclonal specifically detects OAS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OAS2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P29728
• Gene Symbols: OAS2
• Immunogen: Synthetic peptides corresponding to OAS2 (2'-5'-oligoadenylate synthetase 2, 69/71kDa). The peptide sequence was selected from the middle region of OAS2. Peptide sequence AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: (2-5')oligo(A) synthase 2, (2'-5')oligo(A) synthetase 2, (2-5')oligo(A) synthetase 2, 2'5' oligoadenylate synthetase 2, 2-5A synthase 2, 2-5A synthetase 2, 2'-5'-oligoadenylate synthase 2, 2'-5'-oligoadenylate synthetase 2 (69-71 kD), 2'-5'-oligoadenylate synthetase 2, 69/71kDa, EC 2.7.7, EC 2.7.7.-, MGC78578, p69 OAS/ p71 OAS, p69OAS/ p71OAS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4939
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.