Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OAS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | OAS2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15895220
![]() |
Novus Biologicals
NBP15895220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP158952
![]() |
Novus Biologicals
NBP158952 |
100 μL |
Each for $487.50
|
|
|||||
Description
OAS2 Polyclonal specifically detects OAS2 in Human samples. It is validated for Western Blot.Specifications
OAS2 | |
Polyclonal | |
Rabbit | |
P29728 | |
OAS2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
4939 | |
Synthetic peptides corresponding to OAS2 (2'-5'-oligoadenylate synthetase 2, 69/71kDa). The peptide sequence was selected from the middle region of OAS2. Peptide sequence AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title