OAS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158951

Catalog No. NBP158951

Description

OAS2 Polyclonal specifically detects OAS2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OAS2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: (2-5')oligo(A) synthase 2, (2'-5')oligo(A) synthetase 2, (2-5')oligo(A) synthetase 2, 2'5' oligoadenylate synthetase 2, 2-5A synthase 2, 2-5A synthetase 2, 2'-5'-oligoadenylate synthase 2, 2'-5'-oligoadenylate synthetase 2 (69-71 kD), 2'-5'-oligoadenylate synthetase 2, 69/71kDa, EC 2.7.7, EC 2.7.7.-, MGC78578, p69 OAS p71 OAS, p69OAS p71OAS
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4939
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P29728-2
• Gene Symbols: OAS2
• Immunogen: Synthetic peptides corresponding to OAS2(2'-5'-oligoadenylate synthetase 2, 69/71kDa) The peptide sequence was selected from the N terminal of OAS2. Peptide sequence DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only