OCC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238063

Catalog No. NBP238063

Description

OCC1 Polyclonal specifically detects OCC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OCC1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8TAD7
• Gene Symbols: C12orf75
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Adipogenesis Down-Regulated 3, AGD3, C12orf75, Chromosome 12 Open Reading Frame 75, OCC1, OCC-1, Overexpressed In Colon Carcinoma 1, Overexpressed In Colon Carcinoma 1 Protein, Overexpressed In Colon Carcinoma-1, Putative Overexpressed In Colon Carcinoma-1 Protein Variant C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 387882
• Target Species: Human
• Isotype: IgG