Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OCEL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OCEL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OCEL1 Polyclonal specifically detects OCEL1 in Human samples. It is validated for Western Blot.Specifications
OCEL1 | |
Polyclonal | |
Rabbit | |
NP_078854 | |
79629 | |
Synthetic peptide directed towards the C terminal of human OCEL1The immunogen for this antibody is OCEL1. Peptide sequence VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ22709, FWP009, occludin/ELL domain containing 1, occludin/ELL domain-containing protein 1, S863-9 | |
OCEL1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title