OLAH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156829

Catalog No. NBP156829

Description

OLAH Polyclonal specifically detects OLAH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OLAH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.2.14, FLJ11106, medium chain, MGC51852, oleoyl-ACP hydrolaseAURA1, SAST, THEDC1, thioesterase domain containing 1, Thioesterase II
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55301
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NV23
• Gene Symbols: OLAH
• Immunogen: Synthetic peptides corresponding to OLAH(oleoyl-ACP hydrolase) The peptide sequence was selected from the N terminal of OLAH. Peptide sequence MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 83%; Mouse: 76%.
• Target Species: Human, Mouse, Pig, Equine, Rabbit
• Isotype: IgG