Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Olfactomedin-2/Noelin-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310146100UL
Description
Olfactomedin-2/Noelin-2 Polyclonal specifically detects Olfactomedin-2/Noelin-2 in Mouse samples. It is validated for Western Blot.Specifications
Olfactomedin-2/Noelin-2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
neuronal olfactomedin related ER localized protein 2, NOE2noelin 2, noelin-2, NOELIN2, NOELIN2_V1, olfactomedin 2, Olfactomedin-2, OlfC | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactomedin-2/Noelin-2 (NP_776138.2). Peptide sequence NTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQVLYNVTLFHVI | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
93145 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction