Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Olfactomedin-2/Noelin-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	Olfactomedin-2/Noelin-2
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB125193 View Documents View Product Certificates	Novus Biologicals NBP310146100UL	100 μg	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Olfactomedin-2/Noelin-2 Polyclonal specifically detects Olfactomedin-2/Noelin-2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Olfactomedin-2/Noelin-2
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Mouse
Gene Alias	neuronal olfactomedin related ER localized protein 2, NOE2noelin 2, noelin-2, NOELIN2, NOELIN2_V1, olfactomedin 2, Olfactomedin-2, OlfC
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of mouse Olfactomedin-2/Noelin-2 (NP_776138.2). Peptide sequence NTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQVLYNVTLFHVI
Purification Method	Affinity purified

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	93145
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Olfactomedin-2/Noelin-2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents