OLFML2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159547

Catalog No. NBP159547

Description

OLFML2B Polyclonal specifically detects OLFML2B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OLFML2B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZP586L151, MGC51337, olfactomedin-like 2B, olfactomedin-like protein 2B, photomedin-2, RP11-227F8.1
• Host Species: Rabbit
• Molecular Weight of Antigen: 84 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q68BL8
• Gene Symbols: OLFML2B
• Immunogen: Synthetic peptides corresponding to OLFML2B(olfactomedin-like 2B) The peptide sequence was selected from the N terminal of human OLFML2B. Peptide sequence EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25903
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.