Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Oncostatin M/OSM Rabbit anti-Human, Mouse, Rat, Clone: 8O8K9, Novus Biologicals™

Oncostatin M/OSM Rabbit anti-Human, Mouse, Rat, Clone: 8O8K9, Novus Biologicals™
SDP

Catalog No. NB168463 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168463 100 μg
NB168464 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168463 Supplier Novus Biologicals Supplier No. NBP316686100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Oncostatin M/OSM Monoclonal antibody specifically detects Oncostatin M/OSM in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence

Specifications

Antigen Oncostatin M/OSM
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Classification Monoclonal
Clone 8O8K9
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias MGC20461, oncostatin M, oncostatin-M
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Oncostatin M/OSM (P13725). MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Biologically Active Proteins, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 5008
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.