Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
-Immunocytochemistry-Immunofluorescence-NBP3-16686-img0001.jpg-650.jpg)
-Immunohistochemistry-NBP3-16686-img0002.jpg-650.jpg)
-Immunohistochemistry-NBP3-16686-img0003.jpg-650.jpg)
-Western-Blot-NBP3-16686-img0004.jpg-650.jpg)
Oncostatin M/OSM Rabbit anti-Human, Mouse, Rat, Clone: 8O8K9, Novus Biologicals™
Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP31668620UL
Description
Oncostatin M/OSM Monoclonal antibody specifically detects Oncostatin M/OSM in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, ImmunofluorescenceSpecifications
| Oncostatin M/OSM | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence | |
| 8O8K9 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| MGC20461, oncostatin M, oncostatin-M | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Oncostatin M/OSM (P13725). MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLN | |
| 20 μg | |
| Biologically Active Proteins, Cell Cycle and Replication | |
| 5008 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction