OPA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP23420625UL

Catalog No. NB436593

Description

OPA1 Polyclonal specifically detects OPA1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OPA1
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: O60313
• Gene Symbols: OPA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHG
• Quantity: 25 μL
• Research Discipline: Apoptosis, Mitochondrial Fusion Proteins, Neurodegeneration, Neuroscience, Sensory Systems, Vision
• Gene ID (Entrez): 4976
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ12460, KIAA0567dynamin-like 120 kDa protein, mitochondrial, MGM1, mitochondrial dynamin-like GTPase, NPGlargeG, NTGmitochondrial dynamin-like 120 kDa protein, optic atrophy 1 (autosomal dominant), Optic atrophy protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only