OPA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB436593	Novus Biologicals NBP23420625UL	25 μL
NBP234206	Novus Biologicals NBP234206	0.1 mL

Description

OPA1 Polyclonal specifically detects OPA1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: OPA1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Accession No.: O60313
• Gene ID (Entrez): 4976
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Apoptosis, Mitochondrial Fusion Proteins, Neurodegeneration, Neuroscience, Sensory Systems, Vision
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ12460, KIAA0567dynamin-like 120 kDa protein, mitochondrial, MGM1, mitochondrial dynamin-like GTPase, NPGlargeG, NTGmitochondrial dynamin-like 120 kDa protein, optic atrophy 1 (autosomal dominant), Optic atrophy protein 1
• Gene Symbols: OPA1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only