Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR14I1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $499.50

Specifications

Antigen	OR14I1
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB124622 View Documents View Product Certificates	Novus Biologicals NBP30986025UL	25 μg	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB124621 View Documents View Product Certificates	Novus Biologicals NBP309860100UL	100 μg	Each for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

OR14I1 Polyclonal specifically detects OR14I1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	OR14I1
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	olfactory receptor 14I1, Olfactory receptor 5BU1, olfactory receptor, family 14, subfamily I, member 1, olfactory receptor, family 5, subfamily BU, member 1, olfactory receptor, family 5, subfamily BU, member 1 pseudogene, OR5BU1, OR5BU1P
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR14I1. Peptide sequence LGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLF
Purification Method	Affinity purified

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	401994
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

OR14I1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents