Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR14I1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | OR14I1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR14I1 Polyclonal specifically detects OR14I1 in Human samples. It is validated for Western Blot.Specifications
| OR14I1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 14I1, Olfactory receptor 5BU1, olfactory receptor, family 14, subfamily I, member 1, olfactory receptor, family 5, subfamily BU, member 1, olfactory receptor, family 5, subfamily BU, member 1 pseudogene, OR5BU1, OR5BU1P | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR14I1. Peptide sequence LGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCSPQLIVIMLFLTTGLF | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 401994 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title