Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR1L8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1690920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1690920 20 μL
NBP169091 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1690920 Supplier Novus Biologicals Supplier No. NBP16909120UL

Rabbit Polyclonal Antibody

OR1L8 Polyclonal specifically detects OR1L8 in Human samples. It is validated for Western Blot.

Specifications

Antigen OR1L8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias olfactory receptor 1L8, Olfactory receptor OR9-24, olfactory receptor, family 1, subfamily L, member 8, OR9-24
Gene Symbols OR1L8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to OR1L8 (olfactory receptor, family 1, subfamily L, member 8) The peptide sequence was selected from the C terminal of OR1L8. Peptide sequence MTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFSTCGFYLTVVT.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 138881
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.