Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR1M1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR1M1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR1M1 Polyclonal specifically detects OR1M1 in Mouse samples. It is validated for Western Blot.Specifications
| OR1M1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| olfactory receptor 1M1, Olfactory receptor OR19-5, olfactory receptor, family 1, subfamily M, member 1, OR19-5, OR19-6Olfactory receptor 19-6 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of mouse OR1M1 (NP_666817.1). Peptide sequence CPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGALKKIINRKIS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 125963 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title