OR2A25 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309766100UL

Catalog No. NB124433

Description

OR2A25 Polyclonal specifically detects OR2A25 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2A25
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 2A25, Olfactory receptor 2A27, olfactory receptor, family 2, subfamily A, member 24 pseudogene, olfactory receptor, family 2, subfamily A, member 25, olfactory receptor, family 2, subfamily A, member 25 pseudogene, olfactory receptor, family 2, subfamily A, member 27, OR2A24P, OR2A25P, OR2A27
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2A25 (NP_001004488). Peptide sequence LCVVGLFYGTAIIMYVEPQYESPKEQKKYLLLFHSLFNPMLNPLIYSLRN
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 392138
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.