Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                OR2H1 Antibody, Novus Biologicals™
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR2H1 | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
OR2H1 Polyclonal specifically detects OR2H1 in Human samples. It is validated for Western Blot.Specifications
| OR2H1 | |
| Polyclonal | |
| Rabbit | |
| Q9GZK4 | |
| 26716 | |
| Synthetic peptides corresponding to OR2H1 (olfactory receptor, family 2, subfamily H, member 1) The peptide sequence was selected from the C terminal of OR2H1. Peptide sequence IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL. | |
| Primary | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| family 2, subfamily H, member 6, Hs6M1-16, Olfactory receptor 2H6, olfactory receptor, family 2, subfamily H, member 1,6M1-16, olfactory receptor, family 2, subfamily H, member 8, OLFR42A-9004-14, OR2H8, OR6-2HS6M1-16 | |
| OR2H1 | |
| IgG | |
| 35 kDa | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title