Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2H1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR2H1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR2H1 Polyclonal specifically detects OR2H1 in Human samples. It is validated for Western Blot.Specifications
OR2H1 | |
Polyclonal | |
Rabbit | |
Q9GZK4 | |
26716 | |
Synthetic peptides corresponding to OR2H1 (olfactory receptor, family 2, subfamily H, member 1) The peptide sequence was selected from the C terminal of OR2H1. Peptide sequence IAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family 2, subfamily H, member 6, Hs6M1-16, Olfactory receptor 2H6, olfactory receptor, family 2, subfamily H, member 1,6M1-16, olfactory receptor, family 2, subfamily H, member 8, OLFR42A-9004-14, OR2H8, OR6-2HS6M1-16 | |
OR2H1 | |
IgG | |
35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title