OR2T29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169037

Catalog No. NBP169037

Description

OR2T29 Polyclonal specifically detects OR2T29 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR2T29
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: OR2T29
• Immunogen: Synthetic peptides corresponding to OR2T29 (olfactory receptor, family 2, subfamily T, member 29) The peptide sequence was selected from the C terminal of OR2T29. Peptide sequence GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 343563
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 2T29, olfactory receptor, family 2, subfamily T, member 29
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.