Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR2T29 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR2T29 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR2T29 Polyclonal specifically detects OR2T29 in Human samples. It is validated for Western Blot.Specifications
OR2T29 | |
Polyclonal | |
Rabbit | |
olfactory receptor 2T29, olfactory receptor, family 2, subfamily T, member 29 | |
OR2T29 | |
IgG | |
35 kDa |
Western Blot | |
Unconjugated | |
RUO | |
343563 | |
Synthetic peptides corresponding to OR2T29 (olfactory receptor, family 2, subfamily T, member 29) The peptide sequence was selected from the C terminal of OR2T29. Peptide sequence GAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKDVMGALK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title