OR56A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309871100UL

Catalog No. NB124643

Description

OR56A3 Polyclonal specifically detects OR56A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR56A3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 56A3, Olfactory receptor 56A6, olfactory receptor OR11-51, olfactory receptor, family 56, subfamily A, member 2 pseudogene, olfactory receptor, family 56, subfamily A, member 3, olfactory receptor, family 56, subfamily A, member 3 pseudogene, olfactory receptor, family 56, subfamily A, member 6, OR56A2P, OR56A3P, OR56A6
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR56A3 (NP_001003443). Peptide sequence RAVLRLKAEGAVAKALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDV
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 390083
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.