Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR56A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR56A3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR56A3 Polyclonal specifically detects OR56A3 in Human samples. It is validated for Western Blot.Specifications
| OR56A3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| olfactory receptor 56A3, Olfactory receptor 56A6, olfactory receptor OR11-51, olfactory receptor, family 56, subfamily A, member 2 pseudogene, olfactory receptor, family 56, subfamily A, member 3, olfactory receptor, family 56, subfamily A, member 3 pseudogene, olfactory receptor, family 56, subfamily A, member 6, OR56A2P, OR56A3P, OR56A6 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR56A3 (NP_001003443). Peptide sequence RAVLRLKAEGAVAKALSTCGSHFMLILFFSTILLVFVLTHVAKKKVSPDV | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 390083 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title