Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR5B3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | OR5B3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
OR5B3 Polyclonal specifically detects OR5B3 in Human samples. It is validated for Western Blot.Specifications
| OR5B3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 441608 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Olfactory receptor 5B13, olfactory receptor 5B3, Olfactory receptor OR11-239, olfactory receptor, family 5, subfamily B, member 13, olfactory receptor, family 5, subfamily B, member 3, OR11-239, OR5B13, OST129 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5B3 (NP_001005469). Peptide sequence SSSHSMDTDKMAPVFYTMVIPMLNPLVYSLRNKEVKSAFKKVVEKAKLSV | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title