OR5T2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159622

Catalog No. NBP159622

Description

OR5T2 Polyclonal specifically detects OR5T2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR5T2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: olfactory receptor 5T2, Olfactory receptor OR11-177, olfactory receptor, family 5, subfamily T, member 2, OR11-177
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6IFC8
• Gene Symbols: OR5T2
• Immunogen: Synthetic peptides corresponding to OR5T2(olfactory receptor, family 5, subfamily T, member 2) The peptide sequence was selected from the C terminal of OR5T2. Peptide sequence DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 219464
• Target Species: Human
• Isotype: IgG