Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR5T2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR5T2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR5T2 Polyclonal specifically detects OR5T2 in Human samples. It is validated for Western Blot.Specifications
OR5T2 | |
Polyclonal | |
Rabbit | |
Human | |
olfactory receptor 5T2, Olfactory receptor OR11-177, olfactory receptor, family 5, subfamily T, member 2, OR11-177 | |
OR5T2 | |
IgG | |
39 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q6IFC8 | |
219464 | |
Synthetic peptides corresponding to OR5T2(olfactory receptor, family 5, subfamily T, member 2) The peptide sequence was selected from the C terminal of OR5T2. Peptide sequence DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title