OR6C68 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159859

Catalog No. NBP159859

Description

OR6C68 Polyclonal specifically detects OR6C68 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: OR6C68
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: OR6C68
• Immunogen: Synthetic peptides corresponding to OR6C68(olfactory receptor, family 6, subfamily C, member 68) Antibody(against the N terminal of OR6C68. Peptide sequence MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 403284
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: olfactory receptor 6C68, olfactory receptor, family 6, subfamily C, member 68
• Host Species: Rabbit
• Molecular Weight of Antigen: 36 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG