Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
OR6C68 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | OR6C68 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
OR6C68 Polyclonal specifically detects OR6C68 in Human samples. It is validated for Western Blot.Specifications
OR6C68 | |
Polyclonal | |
Rabbit | |
olfactory receptor 6C68, olfactory receptor, family 6, subfamily C, member 68 | |
OR6C68 | |
IgG | |
36 kDa |
Western Blot | |
Unconjugated | |
RUO | |
403284 | |
Synthetic peptides corresponding to OR6C68(olfactory receptor, family 6, subfamily C, member 68) Antibody(against the N terminal of OR6C68. Peptide sequence MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title