Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

OR6C70 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15936320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15936320 20 μL
NBP159363 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15936320 Supplier Novus Biologicals Supplier No. NBP15936320UL

Rabbit Polyclonal Antibody

OR6C70 Polyclonal specifically detects OR6C70 in Human samples. It is validated for Western Blot.

Specifications

Antigen OR6C70
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. A6NIJ9
Gene Alias olfactory receptor 6C70, olfactory receptor, family 6, subfamily C, member 70
Gene Symbols OR6C70
Host Species Rabbit
Immunogen Synthetic peptides corresponding to OR6C70(olfactory receptor, family 6, subfamily C, member 70) The peptide sequence was selected from the C terminal of OR6C70. Peptide sequence GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 390327
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.