Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ORL1/OPRL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16914320UL
Description
ORL1/OPRL1 Polyclonal specifically detects ORL1/OPRL1 in Human samples. It is validated for Western Blot.Specifications
ORL1/OPRL1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
P79292 | |
OPRL1 | |
Synthetic peptides corresponding to OPRL1 (opiate receptor-like 1) The peptide sequence was selected from the middle region of OPRL1. Peptide sequence ISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQ. | |
Affinity Purified | |
RUO | |
Primary | |
Human, Pig | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Kappa-type 3 opioid receptor, KOR-3MGC34578, nociceptin receptor, NOCIR, OORORL1kappa3-related opioid receptor, opiate receptor-like 1, Orphanin FQ receptor | |
Rabbit | |
41 kDa | |
20 μL | |
Signal Transduction | |
4987 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction